Sign In | Join Free | My autoplansearch.com
autoplansearch.com
Products
Search by Category
Wholesale Marketplace
Home > Environment >

Environment Projects

Environment Projects

All Environment Projects wholesalers & Environment Projects manufacturers come from members. We doesn't provide Environment Projects products or service, please contact them directly and verify their companies info carefully.

Total 4959 products from Environment Projects Manufactures & Suppliers
Cheap Programmable LED Pharmacy Cross Signs Small Size Display Animated Message for sale

Brand Name:CGX

Model Number:PL006

Place of Origin:Guangzhou, China

Programmable LED Pharmacy Cross Signs Small Size Display Animated Message Double sided led pharmacy cross is a very effective communication and advertising tool, which can display animated text indoor or outdoor to highlight your pharmacies sign in the ...

Guangzhou Baiyun CGX Electronic Factory
Active Member

Guangdong

Cheap How to Identify Baler Quality for sale

Brand Name:SINOBALER

Place of Origin:CHINA

Baler machines are a long term investment and it is important to know how to identify baler quality before purchasing a new baler. SINOBALER would share some useful tips to help you choose a quality baler.View more details at http://www.sinobaler.com/...

SINOBALER Machinery Company Limited
Active Member

Cheap fiberglass amusement park ride kids outdoor battery inflatable electric bumper car spin bumper car for sale for sale

Brand Name:huaqin

Model Number:BP-002

Place of Origin:Made in China

fiberglass amusement park ride kids outdoor battery inflatable electric bumper car spin bumper car for sale Where To Use Square,park,playground Material Acrylic,hardware Battery time 8-12 hour Power 250W Size L1400*W500*H620mm Start mode Remote control, ...

Guangzhou HuaQin Playground Equipment Co.,ltd
Active Member

Guangdong

Cheap LAMBORGHINI :   600 - 1706	info  	956/DT  1306/DT  1506/DT  1706/DT   R-series	info  	R 95 for sale

Place of Origin:YanCheng

Brand Name:JIAHANG CLUTCH

Model Number:LAMBORGHINI : 600 - 1706 info 956/DT 1306/DT 1506/DT 1706/DT R-series info R 956 R 1306/

LAMBORGHINI : 600 - 1706 956/DT 1306/DT 1506/DT 1706/DT R-series R 956 R 1306/DT R 1356/DT R 1556/DT SAME : GALAXY 170 HERCULES 160 JAGUAR 100 LASER 90 / 100 110 130 150 LEOPARD 90 T TIGER SIX Tiger Six / 105 TITAN Titan TRIDENT Trident 130

YanCheng JIAHANG Clutch Co., Ltd.
Site Member

Jiangsu

Cheap Summer Curtain DESIGN-5 in 2018 for sale

Brand Name:kingsun

Model Number:WHL170920-15

Place of Origin:China

Details 1.Bright color, color uniformity,resistant to crushing and printable nice. 2.Soft hand feeling. 3.a variety of embroideries. 4.Good Quality:We have strict quality control system .Good reputation in the market. 5.Low MOQ: we can meet your ...

SHIJIAZHUANG KINGSUN TEXTILE IMP. & EXP. CO., LTD
Active Member

Cheap Max.tank diameter 4m, SG4 powerful jet tank cleaning spray nozzle for cleaning of small to medium sized tanks for sale

Brand Name:KLY

Model Number:SG4 powerful jet tank cleaning spray nozzle

Place of Origin:CN

SG4 powerful jet tank cleaning spray nozzle Model SG4 tank cleaning spray nozzle Material 316L ss Bearing Slide bearing Operating pressure 3-14bar Max. pressure 20 bar Max. tank diameter 4m Diameter 49mm Filtration line strainer with a mesh size of 80 or ...

Guangzhou cleaning-spray Equipment Co., Ltd
Active Member

Guangdong

Cheap Original   Philips Picco cardiac output  cable,M1643A for sale

Brand Name:Philips

Model Number:M1643A

Original Philips Picco cardiac output cable,M1643A Other original Philips accessories are available.

HongKong BiocareMed Co.,Ltd
Site Member

Guangdong

Cheap Customized decorative panel in metal stainless steel screen partition for interior divider for sale

Brand Name:Screen Partition

Model Number:stainless steel,aluminum,brass,metal

Place of Origin:china supplier metal screen

Customized decorative panel in metal stainless steel screen partition for interior divider CAD DRAWING WELCOME TO QUOTE. SCREEN PARTITION / ROOM DIVIDER/WALL PANEL/LASER CUT SCREEN 1.Material:stainless steel, carbon steel, aluminum,brass 2.finish:8k ...

Foshan Xin Tai Jia Stainless Steel Co.,Ltd
Site Member

Guangdong

Cheap DH80-7 gear pump pilot pump charge pump for DOOSAN DAEWOO excavator for sale

Brand Name:Sailfish

Model Number:DH80-7

Place of Origin:CHINA

DH80-7 gear pump pilot pump charge pump for DOOSAN DAEWOO excavator contact imfoemation:

Sailfish Machinery&Equipment co.,ltd
Site Member

Guangdong

Cheap Personalized Handmade High Quality Crystal Red Wine Glass White Wine Glass for sale

Brand Name:Almayca

Model Number:Al-518

Place of Origin:China

Introduction of Personalized Handmade High Quality Crystal Red Wine Glass White Wine Glass Supply Personalized Handmade High Quality Crystal Red Wine Glass White Wine Glass are top class 518ml crystal wine glasses that widely used for hotel, party, ...

Shandong Almayca Arts & Crafts Co,Ltd
Active Member

Cheap Duct Rodder manufacturer for sale

Brand Name:huaertelecom

Place of Origin:China

Duct Rodder Huaer is specialized in power cable equipments and construction tools. The fiberglass duct rodder produced by our factory has three types: portable duct rodder, wheeled duct rodder and traceable duct rodder. Portable Duct Rodder Mainly ...

Hebei Huaer Trade Co.,Ltd
Active Member

Cheap 360° Rotation 18 Times Zoom Underwater Camera with LED Lights VVL-KS-Z,Sea Observation for sale

Place of Origin:Weihai,China

Brand Name:VVLAI

Model Number:VVL-KS-Z

360° Rotation Underwater Camera 18 Times Zoom Camera with LED Light VVL-KS-Z 1. Product Image: 2. Technical Specification: 1) 7inch high light LCD Screen 2) 2*5W LED light 3) DVR/USB port 4) 18 times zoom camera 5)10M-100M Cable It can equip with 7M long...

Shandong Future Robot Co.,Ltd
Site Member

Shandong

Cheap China Supplier EKEMP Android POS System with RFID, Smart Card Reader, Thermal Printer, Touch Screen for sale

Brand Name:EKEMP

Model Number:P10

Place of Origin:China(Mainland)

China Supplier EKEMP Android POS System with RFID, Smart Card Reader, Thermal Printer, Touch Screen 10.1 inch high-definition touch screen,new Android 4.2.2 operating system, brings a smooth operation and strong performance. Unique bar code scanning and ...

EKEMP INT'L LIMITED
Active Member

Cheap hot selling 230w beam moving head/glass gobos 230w moving head light/double prism 7r moving head dmx512 for sale

Brand Name:Vesitian

Place of Origin:CHINA

Model Number:vm230

hot selling 230w beam moving head/glass gobos 230w moving head light/double prism 7r moving head dmx512 Input Voltage: AC100-240V 50/60HZ Power Consumption: 230W Control Protocol: DMX512 Channel: 16CH Dimming: 0-100% linear adjustment Strobe: heat-proof ...

Guangzhou Vesitian lighting equipment factory
Active Member

Guangdong

Cheap gypsum board equipment for sale

Brand Name:Xiangyi

Place of Origin:Hebei, China

gypsum board processing line gypsum board equipment Finished gypsum board Specification Dimension of gypsum board: Thickness: 7mm-22mm width: 1200mm or 1220mm length: 1800mm~3600mm Types of Gypsum Board a) Common paper surface gypsum board b) Fireproof ...

Hebei Xiangyi Mechanical Co.,Ltd
Active Member

Liaoning

Cheap High Quality of Multifunctional Portable Super Brightness Led Flashlight Torch for sale

Brand Name:KINGFORY

Model Number:MS5

Place of Origin:CHINA GUANGDONG

MS5 multi-functional hand-held flashlight It is a multifunctional hand-held super brightness flashlight. Through the switch on the handle, the three levels of different luminance and signal modes could be shifted conveniently and promptly. With the ...

Dongguan Sunshine Electronics Co Ltd
Active Member

Guangdong

Cheap High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier for sale

Brand Name:Youngshe

Model Number:high quality

Place of Origin:China

Sermorelin Acetate Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-...

Chengdu YoungShe Chemical Co., Ltd
Active Member

Sichuan

Cheap multicolor PU carton watch lovely kid's watch for sale

Brand Name:Seeteng

Model Number:SW2073

Place of Origin:FUZHOU,FUJIAN,CHINA

Product Description multicolor PU carton watch lovely kid's watch Item No: SW2073 Case Material: Alloy Case-back: stainless steel Movement: Chinese/Japanese strap material: PU MOQ: 1000pcs Dimension: L: 22 cm; Dia: 3.6cm ;thick: 0.8cm N.W.: 32g Packing:...

FUZHOU SEETENG ELECTRONIC.CO.TLD
Site Member

Jiangxi

Cheap 10oz. Waterproof PVC Laminated Polyester Fabric for sale

Place of Origin:Ningbo China

Brand Name:polyester fabric pvc

Model Number:KQD-E-017

PVC Laminated Cloth Available in an extensivevariety of colors,weightsrangingfrom0.1mm to 0.8mm, our PVC laminated cloth are ideal for many applications with good property. Application:Bag, Tent, Raincoat, Mattress, Inflatable and so on Property Fire ...

Ningbo KQD Plastic Tech Co., Ltd
Active Member

Zhejiang

Cheap Coater & Post-Treatment Line for sale

Categories:Mineral Water Bottle Caps

Country/Region:china

PRODUCT CENTER Coater & Post-Treatment Line :2017/8/4 Name:Coater & Post-Treatment Line Type:Coater & Post-Treatment Illustrate:CAPA: 200 Ton/M 一:Automatic Plating Barrel 一:Automatic Plating Rack Li

jf limited
ICP Remarked Supplier

Go to Page
Inquiry Cart 0